Candidate Falcon
Verified revenuecandidatefalcon.com
The exact hiring assessment you're about to face Realistic practice for HireVue, SparkHire, Talview, and VidCruiter.
Realistic practice for HireVue, SparkHire, Talview, and VidCruiter.
Revenue, 30 days
$286
Growth, 30 days
-2.1%
MRR
$292
Key facts
- Founder
- Luca Ardito · 378 followers
- Founded
- March 2026
- Based in
- 🇮🇹 Italy
- Payments
- Stripe
- Active subscriptions
- 15
- Plans from
- $12.99 a month
- Revenue, 12 months
- $2,580
- Revenue, all time
- $2,580
- Domain registered
- February 2026
- Registrar
- Porkbun LLC
- Listed on StartupsIntel
- October 2026
Built with
Daily revenue, last 30 days
Verified with StripeMonthly revenue
Verified with StripePopularity by source
October 2026Not in any top-million list
That usually means fewer than about 76.5K visits a month. New and niche sites rarely reach public rankings, we check again every month.
| TrancoResearch list, average of several rankings | Not listed |
|---|---|
| Cloudflare RadarTraffic through Cloudflare's network | Not listed |
| Chrome UX ReportVisits by Chrome users, from Google | Not listed |
| Cisco UmbrellaDNS lookups | Not listed |
| MajesticSites linking to it | Not listed |
Ranks for this exact domain, lower is more popular. How we combine them
Whois information
| Domain | candidatefalcon.com |
|---|---|
| Registrar | Porkbun LLC |
| Registrar ID | 1861 |
| Created date | 2026-02-27 10:22:26 UTC |
| Expires date | 2027-02-27 10:22:26 UTC |
| Updated date | 2026-08-10 15:48:31 UTC |
| Domain status | client delete prohibitedclient transfer prohibited |
| Name servers | dion.ns.cloudflare.comelma.ns.cloudflare.com |
| DNSSEC | unsigned |
Raw whois
Domain Name: CANDIDATEFALCON.COM Registry Domain ID: 3071942693_DOMAIN_COM-VRSN Registrar: Porkbun LLC Registrar IANA ID: 1861 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +1.8557675286 Updated Date: 2026-08-10T15:48:31Z Creation Date: 2026-02-27T10:22:26Z Registry Expiry Date: 2027-02-27T10:22:26Z Domain Status: client delete prohibited Domain Status: client transfer prohibited Name Server: DION.NS.CLOUDFLARE.COM Name Server: ELMA.NS.CLOUDFLARE.COM DNSSEC: unsigned >>> Last update of RDAP database: 2026-10-26T18:04:12Z <<<
SEO audit
15 of 16 checks passed95
SEO score
Response 174 ms · 80 KB
- Served over HTTPS
- Title tag present
- Title length 30 to 60 characters
- Meta description present
- Description length 70 to 160 characters
- Exactly one H1 heading
- Uses H2 sub-headings
- Canonical URL set
- Mobile viewport tag
- Language declared
- Open Graph tags
- Twitter card tags
- Structured data (JSON-LD)
- Images have alt textAdd alt text to 22 images.
- At least 300 words of content
- Responds in under 1.5 seconds
- Title (57 characters)
- HireVue Games & One-Way Interview Prep | Candidate Falcon
- Description (150 characters)
- Prepare for HireVue games and one-way video interviews on HireVue, Spark Hire, Talview, and VidCruiter with realistic practice and AI answer feedback.
- Headings
- 1 H1, 5 H2, 9 H3
- Words on page
- 377
- Links
- 50 internal, 43 external
- Structured data
- Organization, WebSite, WebPage, Service, BreadcrumbList
On-page keywords
| Phrase | Type | Mentions |
|---|---|---|
| falcon reviewscandidate | Two words | 5 |
| reviewscandidate falcon | Two words | 5 |
| testshirevue gamesarctic | Two words | 2 |
| falcon reviewscandidate falcon | Three words | 5 |
| reviewscandidate falcon reviewscandidate | Three words | 4 |
| testshirevue gamesarctic shorescappfinityharverpymetricsplumvideo | Three words | 2 |
| candidates | Word | 10 |
| falcon | Word | 10 |
Tech stack and pricing
Lowest paid plan
$12.99 /month
About Candidate Falcon
What is Candidate Falcon?
The exact hiring assessment you're about to face Realistic practice for HireVue, SparkHire, Talview, and VidCruiter.
How much does Candidate Falcon cost?
Paid plans start at $12.99 per month, based on the public pricing page.
How much revenue does Candidate Falcon make?
Candidate Falcon made $286 in the last 30 days, verified with its payment provider.